Hmdb loader

Showing Protein Nucleoside diphosphate kinase 3 (HMDBP00113)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 23 metabolites
Identification
HMDB Protein ID HMDBP00113
Secondary Accession Numbers
  • 5345
Name Nucleoside diphosphate kinase 3
Synonyms
  1. DR-nm23
  2. NDK 3
  3. NDP kinase 3
  4. NDPKC
  5. Nucleoside diphosphate kinase C
  6. nm23-H3
Gene Name NME3
Protein Type Unknown
Biological Properties
General Function Involved in nucleoside diphosphate kinase activity
Specific Function Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis.
Pathways
  • Purine metabolism
  • Pyrimidine metabolism
Reactions
Adenosine triphosphate + nucleoside diphosphate → ADP + nucleoside triphosphate details
Adenosine triphosphate + ADP → ADP + Adenosine triphosphate details
Adenosine triphosphate + Uridine 5'-diphosphate → ADP + Uridine triphosphate details
Adenosine triphosphate + Guanosine diphosphate → ADP + Guanosine triphosphate details
Adenosine triphosphate + CDP → ADP + Cytidine triphosphate details
Adenosine triphosphate + IDP → ADP + Inosine triphosphate details
Adenosine triphosphate + dADP → ADP + Deoxyadenosine triphosphate details
Adenosine triphosphate + dGDP → ADP + dGTP details
Adenosine triphosphate + dTDP → ADP + Thymidine 5'-triphosphate details
Adenosine triphosphate + dCDP → ADP + dCTP details
Adenosine triphosphate + dUDP → ADP + Deoxyuridine triphosphate details
Adenosine triphosphate + dIDP → ADP + 2'-Deoxyinosine triphosphate details
GO Classification
Biological Process
apoptotic process
CTP biosynthetic process
GTP biosynthetic process
UTP biosynthetic process
induction of apoptosis
Cellular Component
mitochondrion
Function
nucleoside diphosphate kinase activity
binding
catalytic activity
phosphotransferase activity, phosphate group as acceptor
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
Molecular Function
metal ion binding
ATP binding
nucleoside diphosphate kinase activity
Process
ctp biosynthetic process
pyrimidine nucleoside triphosphate biosynthetic process
pyrimidine ribonucleoside triphosphate biosynthetic process
utp biosynthetic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
gtp biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
pyrimidine nucleotide metabolic process
pyrimidine nucleotide biosynthetic process
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q13.3
SNPs NME3
Gene Sequence 
>510 bp
ATGATCTGCCTGGTGCTGACCATCTTCGCTAACCTCTTCCCCGCGGCCTGCACCGGCGCA
CACGAACGCACCTTCCTGGCCGTGAAGCCGGACGGCGTGCAGCGGCGGCTGGTGGGCGAG
ATTGTGCGGCGCTTCGAGAGGAAGGGCTTCAAGTTGGTGGCGCTGAAGCTGGTGCAGGCC
TCCGAGGAGCTGCTGCGTGAGCACTACGCCGAGCTGCGTGAACGCCCGTTCTACGGCCGC
CTTGTCAAGTATATGGCCTCCGGGCCGGTGGTGGCCATGGTTTGGCAGGGGCTGGACGTG
GTGCGCACCTCGCGGGCGCTCATCGGAGCCACGAACCCGGCCGACGCCCCGCCCGGCACC
ATCCGCGGGGATTTCTGCATCGAGGTTGGCAAGAACCTGATTCACGGCAGCGACTCGGTG
GAGAGTGCCCGCCGCGAGATCGCTCTCTGGTTCCGCGCAGACGAGCTCCTCTGCTGGGAG
GACAGCGCTGGGCACTGGCTGTATGAGTAG
Protein Properties
Number of Residues 169
Molecular Weight 19014.85
Theoretical pI 7.834
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>Nucleoside diphosphate kinase 3
MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQA
SEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGT
IRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
GenBank ID Protein 14336763
UniProtKB/Swiss-Prot ID Q13232
UniProtKB/Swiss-Prot Entry Name NDK3_HUMAN
PDB IDs
GenBank Gene ID AE006639
GeneCard ID NME3
GenAtlas ID NME3
HGNC ID HGNC:7851
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daniels RJ, Peden JF, Lloyd C, Horsley SW, Clark K, Tufarelli C, Kearney L, Buckle VJ, Doggett NA, Flint J, Higgs DR: Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16. Hum Mol Genet. 2001 Feb 15;10(4):339-52. [PubMed:11157797 ]
  3. Venturelli D, Martinez R, Melotti P, Casella I, Peschle C, Cucco C, Spampinato G, Darzynkiewicz Z, Calabretta B: Overexpression of DR-nm23, a protein encoded by a member of the nm23 gene family, inhibits granulocyte differentiation and induces apoptosis in 32Dc13 myeloid cells. Proc Natl Acad Sci U S A. 1995 Aug 1;92(16):7435-9. [PubMed:7638209 ]