Showing Protein Pirin (HMDBP11882)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11882 | ||||||||||
Secondary Accession Numbers | None | ||||||||||
Name | Pirin | ||||||||||
Synonyms |
|
||||||||||
Gene Name | PIR | ||||||||||
Protein Type | Unknown | ||||||||||
Biological Properties | |||||||||||
General Function | Not Available | ||||||||||
Specific Function | Possible transcriptional coregulator. May contribute to the regulation of cellular processes via its interaction with BCL3. May be required for efficient terminal myeloid maturation of hematopoietic cells. May play a role in the regulation of cell migration. May promote apoptosis when overexpressed. Has quercetin 2,3-dioxygenase activity (in vitro). | ||||||||||
Pathways |
|
||||||||||
Reactions |
|
||||||||||
GO Classification |
|
||||||||||
Cellular Location | Not Available | ||||||||||
Gene Properties | |||||||||||
Chromosome Location | X | ||||||||||
Locus | Xp22.2 | ||||||||||
SNPs | Not Available | ||||||||||
Gene Sequence | Not Available | ||||||||||
Protein Properties | |||||||||||
Number of Residues | Not Available | ||||||||||
Molecular Weight | 32113.195 | ||||||||||
Theoretical pI | 6.922 | ||||||||||
Pfam Domain Function | |||||||||||
Signals | Not Available | ||||||||||
Transmembrane Regions | Not Available | ||||||||||
Protein Sequence |
>>gi|66363697|ref|NP_001018119.1| pirin [Homo sapiens] MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRG FETVSYLLEG |
||||||||||
External Links | |||||||||||
GenBank ID Protein | Not Available | ||||||||||
UniProtKB/Swiss-Prot ID | O00625 | ||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
PDB IDs | |||||||||||
GenBank Gene ID | Not Available | ||||||||||
GeneCard ID | Not Available | ||||||||||
GenAtlas ID | Not Available | ||||||||||
HGNC ID | HGNC:30048 | ||||||||||
References | |||||||||||
General References | Not Available |