Showing Protein Neuron navigator 2 (HMDBP11850)
Identification | ||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11850 | |||||||||||||||
Secondary Accession Numbers | None | |||||||||||||||
Name | Neuron navigator 2 | |||||||||||||||
Synonyms |
|
|||||||||||||||
Gene Name | NAV2 | |||||||||||||||
Protein Type | Unknown | |||||||||||||||
Biological Properties | ||||||||||||||||
General Function | Not Available | |||||||||||||||
Specific Function | Possesses 3' to 5' helicase activity and exonuclease activity. Involved in neuronal development, specifically in the development of different sensory organs. | |||||||||||||||
Pathways | Not Available | |||||||||||||||
Reactions |
|
|||||||||||||||
GO Classification |
|
|||||||||||||||
Cellular Location | Not Available | |||||||||||||||
Gene Properties | ||||||||||||||||
Chromosome Location | 11 | |||||||||||||||
Locus | 11p15.1 | |||||||||||||||
SNPs | Not Available | |||||||||||||||
Gene Sequence | Not Available | |||||||||||||||
Protein Properties | ||||||||||||||||
Number of Residues | Not Available | |||||||||||||||
Molecular Weight | 254975.72 | |||||||||||||||
Theoretical pI | 8.945 | |||||||||||||||
Pfam Domain Function | Not Available | |||||||||||||||
Signals | Not Available | |||||||||||||||
Transmembrane Regions | Not Available | |||||||||||||||
Protein Sequence |
>>gi|161169015|ref|NP_001104488.1| neuron navigator 2 isoform 3 [Homo sapiens] MESVSESSQQQKRKPVIHGLEDQKRIYTDWANHYLAKSGHKRLIRDLQQDVTDGVLLAQI IQVVANEKIE |
|||||||||||||||
External Links | ||||||||||||||||
GenBank ID Protein | Not Available | |||||||||||||||
UniProtKB/Swiss-Prot ID | Q8IVL1 | |||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||||
PDB IDs | ||||||||||||||||
GenBank Gene ID | Not Available | |||||||||||||||
GeneCard ID | Not Available | |||||||||||||||
GenAtlas ID | Not Available | |||||||||||||||
HGNC ID | HGNC:15997 | |||||||||||||||
References | ||||||||||||||||
General References | Not Available |