Showing Protein N-alpha-acetyltransferase 11 (HMDBP11844)
| Identification | |||||||
|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11844 | ||||||
| Secondary Accession Numbers | None | ||||||
| Name | N-alpha-acetyltransferase 11 | ||||||
| Synonyms |
|
||||||
| Gene Name | NAA11 | ||||||
| Protein Type | Unknown | ||||||
| Biological Properties | |||||||
| General Function | Not Available | ||||||
| Specific Function | In complex with NAA15, displays alpha (N-terminal) acetyltransferase activity. | ||||||
| Pathways | Not Available | ||||||
| Reactions |
|
||||||
| GO Classification |
|
||||||
| Cellular Location | Not Available | ||||||
| Gene Properties | |||||||
| Chromosome Location | 4 | ||||||
| Locus | 4q21.21 | ||||||
| SNPs | Not Available | ||||||
| Gene Sequence | Not Available | ||||||
| Protein Properties | |||||||
| Number of Residues | Not Available | ||||||
| Molecular Weight | 25978.61 | ||||||
| Theoretical pI | 5.176 | ||||||
| Pfam Domain Function | Not Available | ||||||
| Signals | Not Available | ||||||
| Transmembrane Regions | Not Available | ||||||
| Protein Sequence |
>>gi|14249280|ref|NP_116082.1| N-alpha-acetyltransferase 11 [Homo sapiens] MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKM EEEPDDVPHG |
||||||
| External Links | |||||||
| GenBank ID Protein | Not Available | ||||||
| UniProtKB/Swiss-Prot ID | Q9BSU3 | ||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
| PDB IDs | Not Available | ||||||
| GenBank Gene ID | Not Available | ||||||
| GeneCard ID | Not Available | ||||||
| GenAtlas ID | Not Available | ||||||
| HGNC ID | HGNC:28125 | ||||||
| References | |||||||
| General References | Not Available | ||||||