Showing Protein Katanin p60 ATPase-containing subunit A-like 1 (HMDBP11801)
| Identification | |||||||
|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11801 | ||||||
| Secondary Accession Numbers | None | ||||||
| Name | Katanin p60 ATPase-containing subunit A-like 1 | ||||||
| Synonyms |
|
||||||
| Gene Name | KATNAL1 | ||||||
| Protein Type | Unknown | ||||||
| Biological Properties | |||||||
| General Function | Not Available | ||||||
| Specific Function | Regulates microtubule dynamics in Sertoli cells, a process that is essential for spermiogenesis and male fertility. Severs microtubules in an ATP-dependent manner, promoting rapid reorganization of cellular microtubule arrays (By similarity). | ||||||
| Pathways | Not Available | ||||||
| Reactions |
|
||||||
| GO Classification |
|
||||||
| Cellular Location | Not Available | ||||||
| Gene Properties | |||||||
| Chromosome Location | 13 | ||||||
| Locus | 13q12.3 | ||||||
| SNPs | Not Available | ||||||
| Gene Sequence | Not Available | ||||||
| Protein Properties | |||||||
| Number of Residues | Not Available | ||||||
| Molecular Weight | 55391.805 | ||||||
| Theoretical pI | 6.741 | ||||||
| Pfam Domain Function | Not Available | ||||||
| Signals | Not Available | ||||||
| Transmembrane Regions | Not Available | ||||||
| Protein Sequence |
>>gi|62177112|ref|NP_001014402.1| katanin p60 ATPase-containing subunit A-like 1 [Homo sapiens] MNLAEICDNAKKGREYALLGNYDSSMVYYQGVMQQIQRHCQSVRDPAIKGKWQQVRQELL EEYEQVKSIV |
||||||
| External Links | |||||||
| GenBank ID Protein | Not Available | ||||||
| UniProtKB/Swiss-Prot ID | Q9BW62 | ||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
| PDB IDs | Not Available | ||||||
| GenBank Gene ID | Not Available | ||||||
| GeneCard ID | Not Available | ||||||
| GenAtlas ID | Not Available | ||||||
| HGNC ID | HGNC:28361 | ||||||
| References | |||||||
| General References | Not Available | ||||||