Hmdb loader

Showing Protein Peptidyl-tRNA hydrolase ICT1, mitochondrial (HMDBP11792)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP11792
Secondary Accession Numbers None
Name Peptidyl-tRNA hydrolase ICT1, mitochondrial
Synonyms
  1. Digestion substraction 1
  2. Immature colon carcinoma transcript 1 protein
  3. DS-1
Gene Name ICT1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.
Pathways Not Available
Reactions
N-substituted aminoacyl-tRNA + Water → N-substituted amino acid + tRNA details
GO Classification
Biological Process
mitochondrial translational termination
Cellular Component
mitochondrial large ribosomal subunit
Molecular Function
aminoacyl-tRNA hydrolase activity
translation release factor activity, codon nonspecific
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q25.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 23629.855
Theoretical pI 10.074
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|4557657|ref|NP_001536.1| peptidyl-tRNA hydrolase ICT1, mitochondrial precursor [Homo sapiens]
MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWR
VPNGAKQADS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q14197
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:5359
References
General References Not Available