Showing Protein Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 2 (HMDBP11774)
Identification | ||||||||
---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11774 | |||||||
Secondary Accession Numbers | None | |||||||
Name | Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 2 | |||||||
Synonyms |
|
|||||||
Gene Name | PTPLB | |||||||
Protein Type | Unknown | |||||||
Biological Properties | ||||||||
General Function | Not Available | |||||||
Specific Function | Responsible for the dehydration step in very long-chain fatty acid (VLCFA) synthesis. | |||||||
Pathways |
|
|||||||
Reactions |
|
|||||||
GO Classification |
|
|||||||
Cellular Location | Not Available | |||||||
Gene Properties | ||||||||
Chromosome Location | 3 | |||||||
Locus | 3q21.1 | |||||||
SNPs | Not Available | |||||||
Gene Sequence | Not Available | |||||||
Protein Properties | ||||||||
Number of Residues | Not Available | |||||||
Molecular Weight | 28368.145 | |||||||
Theoretical pI | 9.548 | |||||||
Pfam Domain Function | Not Available | |||||||
Signals | Not Available | |||||||
Transmembrane Regions | Not Available | |||||||
Protein Sequence |
>>gi|38257153|ref|NP_940684.1| very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 2 [Homo sapiens] MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGL VRAYLAKGSY |
|||||||
External Links | ||||||||
GenBank ID Protein | Not Available | |||||||
UniProtKB/Swiss-Prot ID | Q6Y1H2 | |||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||
PDB IDs | Not Available | |||||||
GenBank Gene ID | Not Available | |||||||
GeneCard ID | Not Available | |||||||
GenAtlas ID | Not Available | |||||||
HGNC ID | HGNC:9640 | |||||||
References | ||||||||
General References | Not Available |