Showing Protein Gamma-glutamylaminecyclotransferase (HMDBP11746)
| Identification | |||||
|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11746 | ||||
| Secondary Accession Numbers | None | ||||
| Name | Gamma-glutamylaminecyclotransferase | ||||
| Synonyms |
|
||||
| Gene Name | GGACT | ||||
| Protein Type | Unknown | ||||
| Biological Properties | |||||
| General Function | Not Available | ||||
| Specific Function | Contributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine. | ||||
| Pathways | Not Available | ||||
| Reactions |
|
||||
| GO Classification |
|
||||
| Cellular Location | Not Available | ||||
| Gene Properties | |||||
| Chromosome Location | 13 | ||||
| Locus | 13q32.3 | ||||
| SNPs | Not Available | ||||
| Gene Sequence | Not Available | ||||
| Protein Properties | |||||
| Number of Residues | Not Available | ||||
| Molecular Weight | 17328.44 | ||||
| Theoretical pI | 6.88 | ||||
| Pfam Domain Function | Not Available | ||||
| Signals | Not Available | ||||
| Transmembrane Regions | Not Available | ||||
| Protein Sequence |
>>gi|304284846|ref|NP_001182016.1| gamma-glutamylaminecyclotransferase [Homo sapiens] MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSG RLVEGEVYAV |
||||
| External Links | |||||
| GenBank ID Protein | Not Available | ||||
| UniProtKB/Swiss-Prot ID | Q9BVM4 | ||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||
| PDB IDs | |||||
| GenBank Gene ID | Not Available | ||||
| GeneCard ID | Not Available | ||||
| GenAtlas ID | Not Available | ||||
| HGNC ID | HGNC:25100 | ||||
| References | |||||
| General References | Not Available | ||||