Hmdb loader

Showing Protein Fanconi anemia group M protein (HMDBP11735)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 4 metabolites
Identification
HMDB Protein ID HMDBP11735
Secondary Accession Numbers None
Name Fanconi anemia group M protein
Synonyms
  1. Protein FACM
  2. ATP-dependent RNA helicase FANCM
  3. Fanconi anemia-associated polypeptide of 250 kDa
  4. Protein Hef ortholog
  5. FAAP250
Gene Name FANCM
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function ATPase required for FANCD2 ubiquitination, a key reaction in DNA repair. Binds to ssDNA but not to dsDNA. Recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions.
Pathways
  • Fanconi anemia pathway
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
DNA repair
replication fork processing
nucleic acid phosphodiester bond hydrolysis
resolution of meiotic recombination intermediates
Cellular Component
FANCM-MHF complex
Fanconi anaemia nuclear complex
Molecular Function
nuclease activity
ATP binding
ATP-dependent helicase activity
chromatin binding
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 14
Locus 14q21.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 232189.375
Theoretical pI 6.108
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|74959747|ref|NP_065988.1| Fanconi anemia group M protein [Homo sapiens]
MSGRQRTLFQTWGSSISRSSGTPGCSSGTERPQSPGSSKAPLPAAAEAQLESDDDVLLVA
AYEAERQLCL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IYD8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:23168
References
General References Not Available