Showing Protein Dual specificity protein phosphatase 26 (HMDBP11723)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11723 | |||||||||
| Secondary Accession Numbers | None | |||||||||
| Name | Dual specificity protein phosphatase 26 | |||||||||
| Synonyms |
|
|||||||||
| Gene Name | DUSP26 | |||||||||
| Protein Type | Unknown | |||||||||
| Biological Properties | ||||||||||
| General Function | Not Available | |||||||||
| Specific Function | Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK). | |||||||||
| Pathways | Not Available | |||||||||
| Reactions |
|
|||||||||
| GO Classification |
|
|||||||||
| Cellular Location | Not Available | |||||||||
| Gene Properties | ||||||||||
| Chromosome Location | 8 | |||||||||
| Locus | 8p12 | |||||||||
| SNPs | Not Available | |||||||||
| Gene Sequence | Not Available | |||||||||
| Protein Properties | ||||||||||
| Number of Residues | Not Available | |||||||||
| Molecular Weight | 23945.38 | |||||||||
| Theoretical pI | 9.607 | |||||||||
| Pfam Domain Function | Not Available | |||||||||
| Signals | Not Available | |||||||||
| Transmembrane Regions | Not Available | |||||||||
| Protein Sequence |
>>gi|13128968|ref|NP_076930.1| dual specificity protein phosphatase 26 [Homo sapiens] MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACN HADEVWPGLY |
|||||||||
| External Links | ||||||||||
| GenBank ID Protein | Not Available | |||||||||
| UniProtKB/Swiss-Prot ID | Q9BV47 | |||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
| PDB IDs | ||||||||||
| GenBank Gene ID | Not Available | |||||||||
| GeneCard ID | Not Available | |||||||||
| GenAtlas ID | Not Available | |||||||||
| HGNC ID | HGNC:28161 | |||||||||
| References | ||||||||||
| General References | Not Available | |||||||||