Showing Protein Dual specificity protein phosphatase 22 (HMDBP11721)
Identification | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11721 | ||||||||||||||||
Secondary Accession Numbers | None | ||||||||||||||||
Name | Dual specificity protein phosphatase 22 | ||||||||||||||||
Synonyms |
|
||||||||||||||||
Gene Name | DUSP22 | ||||||||||||||||
Protein Type | Unknown | ||||||||||||||||
Biological Properties | |||||||||||||||||
General Function | Not Available | ||||||||||||||||
Specific Function | Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) (By similarity). | ||||||||||||||||
Pathways |
|
||||||||||||||||
Reactions |
|
||||||||||||||||
GO Classification |
|
||||||||||||||||
Cellular Location | Not Available | ||||||||||||||||
Gene Properties | |||||||||||||||||
Chromosome Location | 6 | ||||||||||||||||
Locus | 6p25.3 | ||||||||||||||||
SNPs | Not Available | ||||||||||||||||
Gene Sequence | Not Available | ||||||||||||||||
Protein Properties | |||||||||||||||||
Number of Residues | Not Available | ||||||||||||||||
Molecular Weight | 20909.845 | ||||||||||||||||
Theoretical pI | 8.105 | ||||||||||||||||
Pfam Domain Function | Not Available | ||||||||||||||||
Signals | Not Available | ||||||||||||||||
Transmembrane Regions | Not Available | ||||||||||||||||
Protein Sequence |
>>gi|9910432|ref|NP_064570.1| dual specificity protein phosphatase 22 [Homo sapiens] MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS QNLTRHFKES |
||||||||||||||||
External Links | |||||||||||||||||
GenBank ID Protein | Not Available | ||||||||||||||||
UniProtKB/Swiss-Prot ID | Q9NRW4 | ||||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||||||
PDB IDs | |||||||||||||||||
GenBank Gene ID | Not Available | ||||||||||||||||
GeneCard ID | Not Available | ||||||||||||||||
GenAtlas ID | Not Available | ||||||||||||||||
HGNC ID | HGNC:16077 | ||||||||||||||||
References | |||||||||||||||||
General References | Not Available |