Showing Protein DNA polymerase delta subunit 2 (HMDBP11715)
| Identification | ||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11715 | |||||||||||||
| Secondary Accession Numbers | None | |||||||||||||
| Name | DNA polymerase delta subunit 2 | |||||||||||||
| Synonyms |
|
|||||||||||||
| Gene Name | POLD2 | |||||||||||||
| Protein Type | Unknown | |||||||||||||
| Biological Properties | ||||||||||||||
| General Function | Not Available | |||||||||||||
| Specific Function | The function of the small subunit is not yet clear. | |||||||||||||
| Pathways |
|
|||||||||||||
| Reactions |
|
|||||||||||||
| GO Classification |
|
|||||||||||||
| Cellular Location | Not Available | |||||||||||||
| Gene Properties | ||||||||||||||
| Chromosome Location | 7 | |||||||||||||
| Locus | 7p13 | |||||||||||||
| SNPs | Not Available | |||||||||||||
| Gene Sequence | Not Available | |||||||||||||
| Protein Properties | ||||||||||||||
| Number of Residues | Not Available | |||||||||||||
| Molecular Weight | 51289.0 | |||||||||||||
| Theoretical pI | 5.576 | |||||||||||||
| Pfam Domain Function | Not Available | |||||||||||||
| Signals | Not Available | |||||||||||||
| Transmembrane Regions | Not Available | |||||||||||||
| Protein Sequence |
>>gi|187828568|ref|NP_001120690.1| DNA polymerase delta subunit 2 isoform 1 [Homo sapiens] MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQ MRPFLENRAQ |
|||||||||||||
| External Links | ||||||||||||||
| GenBank ID Protein | Not Available | |||||||||||||
| UniProtKB/Swiss-Prot ID | P49005 | |||||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||
| PDB IDs | ||||||||||||||
| GenBank Gene ID | Not Available | |||||||||||||
| GeneCard ID | Not Available | |||||||||||||
| GenAtlas ID | Not Available | |||||||||||||
| HGNC ID | HGNC:9176 | |||||||||||||
| References | ||||||||||||||
| General References | Not Available | |||||||||||||