Hmdb loader
Identification
HMDB Protein ID HMDBP11612
Secondary Accession Numbers None
Name Alkylated DNA repair protein alkB homolog 8
Synonyms
  1. Probable alpha-ketoglutarate-dependent dioxygenase ABH8
  2. S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8
  3. tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ABH8
Gene Name ALKBH8
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA. Catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA. Has a preference for tRNA(Arg) and tRNA(Glu), and does not bind tRNA(Lys). Required for normal survival after DNA damage. May inhibit apoptosis and promote cell survival and angiogenesis.
Pathways Not Available
Reactions
S-Adenosylmethionine + carboxymethyluridine(34) in tRNA → S-Adenosylhomocysteine + 5-(2-methoxy-2-oxoethyl)uridine(34) in tRNA details
GO Classification
Biological Process
response to DNA damage stimulus
Cellular Component
cytosol
microtubule cytoskeleton
nucleus
Molecular Function
metal ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
tRNA (uracil) methyltransferase activity
RNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11q22.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 75207.875
Theoretical pI 7.987
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|195927056|ref|NP_620130.2| alkylated DNA repair protein alkB homolog 8 [Homo sapiens]
MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQ
LLPVLEKCGL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96BT7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25189
References
General References Not Available