Identification |
HMDB Protein ID
| HMDBP11611 |
Secondary Accession Numbers
| None |
Name
| Alkylated DNA repair protein alkB homolog 1 |
Synonyms
|
- Alpha-ketoglutarate-dependent dioxygenase ABH1
- DNA lyase ABH1
- DNA oxidative demethylase ALKBH1
|
Gene Name
| ALKBH1 |
Protein Type
| Unknown |
Biological Properties |
General Function
| Not Available |
Specific Function
| Dioxygenase that repairs alkylated single-stranded DNA and RNA containing 3-methylcytosine by oxidative demethylation. Requires molecular oxygen, alpha-ketoglutarate and iron. May have a role in placental trophoblast lineage differentiation (By similarity). Has DNA lyase activity and introduces double-stranded breaks at abasic sites. Cleaves both single-stranded DNA and double-stranded DNA at abasic sites, with the greatest activity towards double-stranded DNA with two abasic sites. DNA lyase activity does not require alpha-ketoglutarate and iron.
|
Pathways
|
Not Available
|
Reactions
|
DNA-base-CH(3) + Oxoglutaric acid + Oxygen → DNA-base + Formaldehyde + Succinic acid + CO(2) |
details
|
|
GO Classification
|
Biological Process |
developmental growth |
DNA dealkylation involved in DNA repair |
in utero embryonic development |
neuron migration |
neuron projection development |
oxidative demethylation |
RNA repair |
DNA demethylation |
placenta development |
Cellular Component |
mitochondrion |
nuclear euchromatin |
Molecular Function |
ferrous iron binding |
chemoattractant activity |
DNA-(apurinic or apyrimidinic site) lyase activity |
methylcytosine dioxygenase activity |
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
|
Cellular Location
|
Not Available
|
Gene Properties |
Chromosome Location
| 14 |
Locus
| 14q24.3 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 43831.39 |
Theoretical pI
| 7.077 |
Pfam Domain Function
|
|
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>>gi|87298840|ref|NP_006011.2| alkylated DNA repair protein alkB homolog 1 [Homo sapiens]
MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQ
KVIKSQLNVS
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q13686 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:17911 |
References |
General References
| Not Available |