Hmdb loader
Identification
HMDB Protein ID HMDBP11603
Secondary Accession Numbers None
Name Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
Synonyms
  1. ADPRibase-Mn
  2. CDP-choline phosphohydrolase
Gene Name ADPRM
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress (By similarity).
Pathways
  • Glycerophospholipid metabolism
  • Purine metabolism
Reactions
Citicoline + Water → Cytidine monophosphate + Phosphorylcholine details
Adenosine diphosphate ribose + Water → Adenosine monophosphate + D-Ribose 5-phosphate details
CDP-glycerol + Water → Cytidine monophosphate + Glycerol 3-phosphate details
Adenosine diphosphate ribose + Water → Adenosine monophosphate + D-Ribose 5-phosphate details
GO Classification
Molecular Function
metal ion binding
ADP-ribose diphosphatase activity
CDP-glycerol diphosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17p13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 39529.105
Theoretical pI 5.588
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|94158594|ref|NP_064618.3| manganese-dependent ADP-ribose/CDP-alcohol diphosphatase [Homo sapiens]
MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWN
NESSMPCCVL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q3LIE5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:30925
References
General References Not Available