Hmdb loader

Showing Protein 14 kDa phosphohistidine phosphatase (HMDBP11578)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 15 metabolites
Identification
HMDB Protein ID HMDBP11578
Secondary Accession Numbers
  • 21022
Name 14 kDa phosphohistidine phosphatase
Synonyms
  1. Phosphohistidine phosphatase 1
  2. Protein janus-A homolog
Gene Name PHPT1
Protein Type Enzyme
Biological Properties
General Function Involved in phosphohistidine phosphatase activity
Specific Function Exhibits phosphohistidine phosphatase activity.
Pathways
  • Fructose and mannose metabolism
  • Fructose and mannose metabolism
  • Fructose intolerance, hereditary
  • Fructosuria
Reactions
NADP + Water → Phosphate + NAD details
Beta-D-Fructose 2-phosphate + Water → D-Fructose + Phosphate details
N-Acetylmannosamine + Phosphate → N-Acetyl-D-mannosamine 6-phosphate + Water details
GO Classification
Biological Process
negative regulation of ATP citrate synthase activity
negative regulation of lyase activity
peptidyl-histidine dephosphorylation
regulation of actin cytoskeleton reorganization
positive regulation of cell motility
negative regulation of T cell receptor signaling pathway
Cellular Component
cytosol
Molecular Function
phosphoprotein phosphatase activity
phosphohistidine phosphatase activity
calcium channel inhibitor activity
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs PHPT1
Gene Sequence 
>378 bp
ATGGCGGTGGCGGACCTCGCTCTCATTCCTGATGTGGACATCGACTCCGACGGCGTCTTC
AAGTATGTGCTGATCCGAGTCCACTCGGCTCCCCGCTCCGGGGCTCCGGCTGCAGAGAGC
AAGGAGATCGTGCGCGGCTACAAGTGGGCTGAGTACCATGCGGACATCTACGACAAAGTG
TCGGGCGACATGCAGAAGCAAGGCTGCGACTGTGAGTGTCTGGGCGGCGGGCGCATCTCC
CACCAGAGTCAGGACAAGAAGATTCACGTGTACGGCTATTCCATGGCCTATGGTCCTGCC
CAGCACGCCATTTCAACTGAGAAAATCAAAGCCAAGTACCCCGACTACGAGGTCACCTGG
GCTAACGACGGCTACTGA
Protein Properties
Number of Residues 125
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>14 kDa phosphohistidine phosphatase
MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKV
SGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTW
ANDGY
GenBank ID Protein 8895093
UniProtKB/Swiss-Prot ID Q9NRX4
UniProtKB/Swiss-Prot Entry Name PHP14_HUMAN
PDB IDs
GenBank Gene ID AF164795
GeneCard ID PHPT1
GenAtlas ID PHPT1
HGNC ID HGNC:30033
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  5. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  6. Ek P, Pettersson G, Ek B, Gong F, Li JP, Zetterqvist O: Identification and characterization of a mammalian 14-kDa phosphohistidine phosphatase. Eur J Biochem. 2002 Oct;269(20):5016-23. [PubMed:12383260 ]
  7. Lai CH, Chiu JY, Lin W: Identification of the human crooked neck gene by comparative gene identification. Biochim Biophys Acta. 2001 Feb 16;1517(3):449-54. [PubMed:11342225 ]
  8. Ma R, Kanders E, Sundh UB, Geng M, Ek P, Zetterqvist O, Li JP: Mutational study of human phosphohistidine phosphatase: effect on enzymatic activity. Biochem Biophys Res Commun. 2005 Nov 25;337(3):887-91. Epub 2005 Sep 30. [PubMed:16219293 ]
  9. Busam RD, Thorsell AG, Flores A, Hammarstrom M, Persson C, Hallberg BM: First structure of a eukaryotic phosphohistidine phosphatase. J Biol Chem. 2006 Nov 10;281(45):33830-4. Epub 2006 Sep 21. [PubMed:16990267 ]
  10. Gong W, Li Y, Cui G, Hu J, Fang H, Jin C, Xia B: Solution structure and catalytic mechanism of human protein histidine phosphatase 1. Biochem J. 2009 Mar 1;418(2):337-44. doi: 10.1042/BJ20081571. [PubMed:18991813 ]