Hmdb loader
Identification
HMDB Protein ID HMDBP10685
Secondary Accession Numbers
  • 16944
Name Dynein light chain 1, cytoplasmic
Synonyms
  1. 8 kDa dynein light chain
  2. DLC8
  3. Dynein light chain LC8-type 1
  4. PIN
  5. Protein inhibitor of neuronal nitric oxide synthase
Gene Name DYNLL1
Protein Type Enzyme
Biological Properties
General Function Involved in microtubule-based process
Specific Function Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
microtubule associated complex
Process
cellular process
microtubule-based process
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Mitochondrion
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24.23
SNPs DYNLL1
Gene Sequence
>267 bp
ATGTGCGACCGAAAGGCCGTGATCAAAAATGCGGACATGTCGGAAGAGATGCAACAGGAC
TCGGTGGAGTGCGCTACTCAGGCGCTGGAGAAATACAACATAGAGAAGGACATTGCGGCT
CATATCAAGAAGGAATTTGACAAGAAGTACAATCCCACCTGGCATTGCATCGTGGGGAGG
AACTTCGGTAGTTATGTGACACATGAAACCAAACACTTCATCTACTTCTACCTGGGCCAA
GTGGCCATTCTTCTGTTCAAATCTGGT
Protein Properties
Number of Residues 89
Molecular Weight 10365.8
Theoretical pI 7.5
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Dynein light chain 1, cytoplasmic
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
GenBank ID Protein 47115281
UniProtKB/Swiss-Prot ID P63167
UniProtKB/Swiss-Prot Entry Name DYL1_HUMAN
PDB IDs
GenBank Gene ID CR407672
GeneCard ID DYNLL1
GenAtlas ID DYNLL1
HGNC ID HGNC:15476
References
General References
  1. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  2. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  3. Rayala SK, den Hollander P, Balasenthil S, Yang Z, Broaddus RR, Kumar R: Functional regulation of oestrogen receptor pathway by the dynein light chain 1. EMBO Rep. 2005 Jun;6(6):538-44. [PubMed:15891768 ]
  4. Rayala SK, den Hollander P, Manavathi B, Talukder AH, Song C, Peng S, Barnekow A, Kremerskothen J, Kumar R: Essential role of KIBRA in co-activator function of dynein light chain 1 in mammalian cells. J Biol Chem. 2006 Jul 14;281(28):19092-9. Epub 2006 May 9. [PubMed:16684779 ]
  5. Dick T, Ray K, Salz HK, Chia W: Cytoplasmic dynein (ddlc1) mutations cause morphogenetic defects and apoptotic cell death in Drosophila melanogaster. Mol Cell Biol. 1996 May;16(5):1966-77. [PubMed:8628263 ]
  6. Puthalakath H, Huang DC, O'Reilly LA, King SM, Strasser A: The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. Mol Cell. 1999 Mar;3(3):287-96. [PubMed:10198631 ]
  7. Vadlamudi RK, Bagheri-Yarmand R, Yang Z, Balasenthil S, Nguyen D, Sahin AA, den Hollander P, Kumar R: Dynein light chain 1, a p21-activated kinase 1-interacting substrate, promotes cancerous phenotypes. Cancer Cell. 2004 Jun;5(6):575-85. [PubMed:15193260 ]
  8. Jeong W, Chang TS, Boja ES, Fales HM, Rhee SG: Roles of TRP14, a thioredoxin-related protein in tumor necrosis factor-alpha signaling pathways. J Biol Chem. 2004 Jan 30;279(5):3151-9. Epub 2003 Nov 7. [PubMed:14607843 ]
  9. Song C, Wen W, Rayala SK, Chen M, Ma J, Zhang M, Kumar R: Serine 88 phosphorylation of the 8-kDa dynein light chain 1 is a molecular switch for its dimerization status and functions. J Biol Chem. 2008 Feb 15;283(7):4004-13. Epub 2007 Dec 14. [PubMed:18084006 ]
  10. Lightcap CM, Sun S, Lear JD, Rodeck U, Polenova T, Williams JC: Biochemical and structural characterization of the Pak1-LC8 interaction. J Biol Chem. 2008 Oct 3;283(40):27314-24. doi: 10.1074/jbc.M800758200. Epub 2008 Jul 23. [PubMed:18650427 ]
  11. Liang J, Jaffrey SR, Guo W, Snyder SH, Clardy J: Structure of the PIN/LC8 dimer with a bound peptide. Nat Struct Biol. 1999 Aug;6(8):735-40. [PubMed:10426949 ]