Hmdb loader

Showing Protein G protein-activated inward rectifier potassium channel 4 (HMDBP08743)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 3 metabolites
Identification
HMDB Protein ID HMDBP08743
Secondary Accession Numbers
  • 14466
Name G protein-activated inward rectifier potassium channel 4
Synonyms
  1. CIR
  2. Cardiac inward rectifier
  3. GIRK-4
  4. Heart KATP channel
  5. IRK-4
  6. Inward rectifier K(+) channel Kir3.4
  7. KATP-1
  8. Potassium channel, inwardly rectifying subfamily J member 5
Gene Name KCNJ5
Protein Type Unknown
Biological Properties
General Function Involved in inward rectifier potassium channel activity
Specific Function This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium
Pathways
  • Acebutolol Action Pathway
  • Alprenolol Action Pathway
  • Amiodarone Action Pathway
  • Amlodipine Action Pathway
  • Arbutamine Action Pathway
  • Atenolol Action Pathway
  • Betaxolol Action Pathway
  • Bevantolol Action Pathway
  • Bisoprolol Action Pathway
  • Bopindolol Action Pathway
  • Bupranolol Action Pathway
  • Carteolol Action Pathway
  • Carvedilol Action Pathway
  • Diltiazem Action Pathway
  • Disopyramide Action Pathway
  • Dobutamine Action Pathway
  • Epinephrine Action Pathway
  • Esmolol Action Pathway
  • Felodipine Action Pathway
  • Flecainide Action Pathway
  • Fosphenytoin (Antiarrhythmic) Action Pathway
  • Ibutilide Action Pathway
  • Isoprenaline Action Pathway
  • Isradipine Action Pathway
  • Labetalol Action Pathway
  • Levobunolol Action Pathway
  • Lidocaine (Antiarrhythmic) Action Pathway
  • Metipranolol Action Pathway
  • Metoprolol Action Pathway
  • Mexiletine Action Pathway
  • Muscle/Heart Contraction
  • Nadolol Action Pathway
  • Nebivolol Action Pathway
  • Nifedipine Action Pathway
  • Nimodipine Action Pathway
  • Nisoldipine Action Pathway
  • Nitrendipine Action Pathway
  • Oxprenolol Action Pathway
  • Penbutolol Action Pathway
  • Phenytoin (Antiarrhythmic) Action Pathway
  • Pindolol Action Pathway
  • Practolol Action Pathway
  • Procainamide (Antiarrhythmic) Action Pathway
  • Propranolol Action Pathway
  • Quinidine Action Pathway
  • Sotalol Action Pathway
  • Timolol Action Pathway
  • Tocainide Action Pathway
  • Verapamil Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
g-protein activated inward rectifier potassium channel activity
ion channel activity
inward rectifier potassium channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q24
SNPs KCNJ5
Gene Sequence 
>1260 bp
ATGGCTGGCGATTCTAGGAATGCCATGAACCAGGACATGGAGATTGGAGTCACTCCCTGG
GACCCCAAGAAGATTCCAAAACAGGCCCGCGATTATGTCCCCATTGCCACAGACCGTACG
CGCCTGCTGGCCGAGGGCAAGAAGCCACGCCAGCGCTACATGGAGAAGAGTGGCAAGTGC
AACGTGCACCACGGCAACGTCCAGGAGACCTACCGGTACCTGAGTGACCTCTTCACCACC
CTGGTGGACCTCAAGTGGCGCTTCAACTTGCTCGTCTTCACCATGGTTTACACTGTCACC
TGGCTGTTCTTCGGCTTCATTTGGTGGCTCATTGCTTATATCCGGGGTGACCTGGACCAT
GTTGGCGACCAAGAGTGGATTCCTTGTGTTGAAAACCTCAGTGGCTTCGTGTCCGCTTTC
CTGTTCTCCATTGAGACCGAAACAACCATTGGGTATGGCTTCCGAGTCATCACAGAGAAG
TGTCCAGAGGGGATTATACTCCTCTTGGTCCAGGCCATCCTGGGCTCCATCGTCAATGCC
TTCATGGTGGGGTGCATGTTTGTCAAGATCAGCCAGCCCAAGAAGAGAGCGGAGACCCTC
ATGTTTTCCAACAACGCAGTCATCTCCATGCGGGACGAGAAGCTGTGCCTCATGTTCCGG
GTGGGCGACCTCCGCAACTCCCACATCGTGGAGGCCTCCATCCGGGCCAAGCTCATCAAG
TCCCGGCAGACCAAAGAGGGGGAGTTCATCCCCCTGAACCAGACAGACATCAACGTGGGC
TTTGACACGGGCGACGACCGCCTCTTCCTTGTGTCTCCTCTGATCATCTCCCATGAGATC
AACCAGAAGAGCCCTTTCTGGGAGATGTCTCAGGCTCAGCTGCATCAGGAAGAGTTTGAA
GTTGTGGTCATTCTAGAAGGGATGGTGGAAGCCACAGGCATGACCTGCCAAGCCCGGAGC
TCCTACATGGATACAGAGGTGCTCTGGGGCCACCGATTCACACCAGTCCTCACCTTGGAA
AAGGGCTTCTATGAGGTGGACTACAACACCTTCCATGATACCTATGAGACCAACACACCC
AGCTGCTGTGCCAAGGAGCTGGCAGAAATGAAGAGGGAAGGCCGGCTCCTCCAGTACCTC
CCCAGCCCCCCACTGCTGGGGGGCTGTGCTGAGGCAGGGCTGGATGCAGAGGCTGAGCAG
AATGAAGAAGATGAGCCCAAGGGGCTGGGTGGGTCCAGGGAGGCCAGGGGCTCGGTGTGA
Protein Properties
Number of Residues 419
Molecular Weight 47667.3
Theoretical pI 5.03
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 87-111
  • 164-185
Protein Sequence 
>G protein-activated inward rectifier potassium channel 4
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
GenBank ID Protein 24797141
UniProtKB/Swiss-Prot ID P48544
UniProtKB/Swiss-Prot Entry Name IRK5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_000890.3
GeneCard ID KCNJ5
GenAtlas ID KCNJ5
HGNC ID HGNC:6266
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. Schoots O, Wilson JM, Ethier N, Bigras E, Hebert TE, Van Tol HH: Co-expression of human Kir3 subunits can yield channels with different functional properties. Cell Signal. 1999 Dec;11(12):871-83. [PubMed:10659995 ]
  4. Ashford ML, Bond CT, Blair TA, Adelman JP: Cloning and functional expression of a rat heart KATP channel. Nature. 1994 Aug 11;370(6489):456-9. [PubMed:8047164 ]
  5. Ashford ML, Bond CT, Blair TA, Adelman JP: Cloning and functional expression of a rat heart KATP channel. Nature. 1995 Dec 21-28;378(6559):792. [PubMed:8524415 ]
  6. Spauschus A, Lentes KU, Wischmeyer E, Dissmann E, Karschin C, Karschin A: A G-protein-activated inwardly rectifying K+ channel (GIRK4) from human hippocampus associates with other GIRK channels. J Neurosci. 1996 Feb 1;16(3):930-8. [PubMed:8558261 ]
  7. Iizuka M, Kubo Y, Tsunenari I, Pan CX, Akiba I, Kono T: Functional characterization and localization of a cardiac-type inwardly rectifying K+ channel. Receptors Channels. 1995;3(4):299-315. [PubMed:8834003 ]