Hmdb loader

Showing Protein Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 (HMDBP08405)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 3 metabolites
Identification
HMDB Protein ID HMDBP08405
Secondary Accession Numbers
  • 14117
Name Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Synonyms Not Available
Gene Name GNG12
Protein Type Unknown
Biological Properties
General Function Involved in signal transducer activity
Specific Function Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction
Pathways
  • Corticotropin Activation of Cortisol Production
  • Dopamine Activation of Neurological Reward System
  • Excitatory Neural Signalling Through 5-HTR 4 and Serotonin
  • Excitatory Neural Signalling Through 5-HTR 6 and Serotonin
  • Excitatory Neural Signalling Through 5-HTR 7 and Serotonin
  • Intracellular Signalling Through Adenosine Receptor A2a and Adenosine
  • Intracellular Signalling Through Adenosine Receptor A2b and Adenosine
  • Intracellular Signalling Through FSH Receptor and Follicle Stimulating Hormone
  • Intracellular Signalling Through Histamine H2 Receptor and Histamine
  • Intracellular Signalling Through LHCGR Receptor and Luteinizing Hormone/Choriogonadotropin
  • Intracellular Signalling Through PGD2 receptor and Prostaglandin D2
  • Intracellular Signalling Through Prostacyclin Receptor and Prostacyclin
  • Vasopressin Regulation of Water Homeostasis
Reactions Not Available
GO Classification
Component
cell part
membrane part
extrinsic to membrane
extrinsic to plasma membrane
heterotrimeric g-protein complex
Function
molecular transducer activity
signal transducer activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. Cytoplasmic side (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 1p31.3
SNPs GNG12
Gene Sequence 
>219 bp
ATGTCCAGCAAAACAGCAAGCACCAACAATATAGCCCAGGCAAGGAGAACTGTGCAGCAG
TTAAGATTAGAAGCCTCCATTGAAAGAATAAAGGTTTCGAAGGCATCAGCGGACCTCATG
TCCTACTGTGAGGAACATGCCAGGAGTGACCCTTTGCTGATAGGAATACCAACTTCAGAA
AACCCTTTCAAGGATAAAAAAACTTGCATCATCTTATAG
Protein Properties
Number of Residues 72
Molecular Weight 8006.1
Theoretical pI 9.38
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
GenBank ID Protein 6563252
UniProtKB/Swiss-Prot ID Q9UBI6
UniProtKB/Swiss-Prot Entry Name GBG12_HUMAN
PDB IDs Not Available
GenBank Gene ID AF119663
GeneCard ID GNG12
GenAtlas ID GNG12
HGNC ID HGNC:19663
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Wang Y, Du D, Fang L, Yang G, Zhang C, Zeng R, Ullrich A, Lottspeich F, Chen Z: Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling. EMBO J. 2006 Nov 1;25(21):5058-70. Epub 2006 Oct 19. [PubMed:17053785 ]
  6. Hurowitz EH, Melnyk JM, Chen YJ, Kouros-Mehr H, Simon MI, Shizuya H: Genomic characterization of the human heterotrimeric G protein alpha, beta, and gamma subunit genes. DNA Res. 2000 Apr 28;7(2):111-20. [PubMed:10819326 ]
  7. Cook LA, Schey KL, Cleator JH, Wilcox MD, Dingus J, Hildebrandt JD: Identification of a region in G protein gamma subunits conserved across species but hypervariable among subunit isoforms. Protein Sci. 2001 Dec;10(12):2548-55. [PubMed:11714923 ]