Hmdb loader

Showing Protein Linker for activation of T-cells family member 1 (HMDBP07770)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP07770
Secondary Accession Numbers
  • 13479
Name Linker for activation of T-cells family member 1
Synonyms
  1. 36 kDa phospho-tyrosine adapter protein
  2. p36-38
  3. pp36
Gene Name LAT
Protein Type Unknown
Biological Properties
General Function Involved in signal transduction
Specific Function Required for TCR (T-cell antigen receptor)- and pre-TCR- mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules
Pathways
  • Fc Epsilon Receptor I Signaling in Mast Cells
Reactions Not Available
GO Classification
Component
membrane
cell part
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location
  1. Cell membrane
  2. Single-pass type III membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 16p11.2
SNPs LAT
Gene Sequence 
>789 bp
ATGGAGGAGGCCATCCTGGTCCCCTGCGTGCTGGGGCTCCTGCTGCTGCCCATCCTGGCC
ATGTTGATGGCACTGTGTGTGCACTGCCACAGACTGCCAGGCTCCTACGACAGCACATCC
TCAGATAGTTTGTATCCAAGGGGCATCCAGTTCAAACGGCCTCACACGGTTGCCCCCTGG
CCACCTGCCTACCCACCTGTCACCTCCTACCCACCCCTGAGCCAGCCAGACCTGCTCCCC
ATCCCAAGATCCCCGCAGCCCCTTGGGGGCTCCCACCGGACGCCATCTTCCCGGCGGGAT
TCTGATGGTGCCAACAGTGTGGCGAGCTACGAGAACGAGGGTGCGTCTGGGATCCGAGGT
GCCCAGGCTGGGTGGGGAGTCTGGGGTCCGTCCTGGACTAGGCTGACCCCTGTGTCGTTA
CCCCCAGAACCAGCCTGTGAGGATGCGGATGAGGATGAGGACGACTATCACAACCCAGGC
TACCTGGTGGTGCTTCCTGACAGCACCCCGGCCACTAGCACTGCTGCCCCATCAGCTCCT
GCACTCAGCACCCCTGGCATCCGAGACAGTGCCTTCTCCATGGAGTCCATTGATGATTAC
GTGAACGTTCCGGAGAGCGGGGAGAGCGCAGAAGCGTCTCTGGATGGCAGCCGGGAGTAT
GTGAATGTGTCCCAGGAACTGCATCCTGGAGCGGCTAAGACTGAGCCTGCCGCCCTGAGT
TCCCAGGAGGCAGAGGAAGTGGAGGAAGAGGGGGCTCCAGATTACGAGAATCTGCAGGAG
CTGAACTGA
Protein Properties
Number of Residues 262
Molecular Weight 27929.4
Theoretical pI 4.01
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 5-27
Protein Sequence 
>Linker for activation of T-cells family member 1
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPW
PPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRG
AQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAP
ALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALS
SQEAEEVEEEGAPDYENLQELN
GenBank ID Protein 7657293
UniProtKB/Swiss-Prot ID O43561
UniProtKB/Swiss-Prot Entry Name LAT_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014387.3
GeneCard ID LAT
GenAtlas ID LAT
HGNC ID HGNC:18874
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  4. Zhang W, Sloan-Lancaster J, Kitchen J, Trible RP, Samelson LE: LAT: the ZAP-70 tyrosine kinase substrate that links T cell receptor to cellular activation. Cell. 1998 Jan 9;92(1):83-92. [PubMed:9489702 ]
  5. Lindholm CK, Gylfe E, Zhang W, Samelson LE, Welsh M: Requirement of the Src homology 2 domain protein Shb for T cell receptor-dependent activation of the interleukin-2 gene nuclear factor for activation of T cells element in Jurkat T cells. J Biol Chem. 1999 Sep 24;274(39):28050-7. [PubMed:10488157 ]
  6. Weber JR, Orstavik S, Torgersen KM, Danbolt NC, Berg SF, Ryan JC, Tasken K, Imboden JB, Vaage JT: Molecular cloning of the cDNA encoding pp36, a tyrosine-phosphorylated adaptor protein selectively expressed by T cells and natural killer cells. J Exp Med. 1998 Apr 6;187(7):1157-61. [PubMed:9529333 ]
  7. Zhang W, Trible RP, Samelson LE: LAT palmitoylation: its essential role in membrane microdomain targeting and tyrosine phosphorylation during T cell activation. Immunity. 1998 Aug;9(2):239-46. [PubMed:9729044 ]
  8. Jevremovic D, Billadeau DD, Schoon RA, Dick CJ, Irvin BJ, Zhang W, Samelson LE, Abraham RT, Leibson PJ: Cutting edge: a role for the adaptor protein LAT in human NK cell-mediated cytotoxicity. J Immunol. 1999 Mar 1;162(5):2453-6. [PubMed:10072481 ]
  9. Zhang W, Trible RP, Zhu M, Liu SK, McGlade CJ, Samelson LE: Association of Grb2, Gads, and phospholipase C-gamma 1 with phosphorylated LAT tyrosine residues. Effect of LAT tyrosine mutations on T cell angigen receptor-mediated signaling. J Biol Chem. 2000 Jul 28;275(30):23355-61. [PubMed:10811803 ]
  10. Tridandapani S, Lyden TW, Smith JL, Carter JE, Coggeshall KM, Anderson CL: The adapter protein LAT enhances fcgamma receptor-mediated signal transduction in myeloid cells. J Biol Chem. 2000 Jul 7;275(27):20480-7. [PubMed:10781611 ]
  11. Asazuma N, Wilde JI, Berlanga O, Leduc M, Leo A, Schweighoffer E, Tybulewicz V, Bon C, Liu SK, McGlade CJ, Schraven B, Watson SP: Interaction of linker for activation of T cells with multiple adapter proteins in platelets activated by the glycoprotein VI-selective ligand, convulxin. J Biol Chem. 2000 Oct 27;275(43):33427-34. [PubMed:10942756 ]
  12. Paz PE, Wang S, Clarke H, Lu X, Stokoe D, Abo A: Mapping the Zap-70 phosphorylation sites on LAT (linker for activation of T cells) required for recruitment and activation of signalling proteins in T cells. Biochem J. 2001 Jun 1;356(Pt 2):461-71. [PubMed:11368773 ]
  13. Sommers CL, Samelson LE, Love PE: LAT: a T lymphocyte adapter protein that couples the antigen receptor to downstream signaling pathways. Bioessays. 2004 Jan;26(1):61-7. [PubMed:14696041 ]
  14. Tedoldi S, Paterson JC, Hansmann ML, Natkunam Y, Rudiger T, Angelisova P, Du MQ, Roberton H, Roncador G, Sanchez L, Pozzobon M, Masir N, Barry R, Pileri S, Mason DY, Marafioti T, Horejsi V: Transmembrane adaptor molecules: a new category of lymphoid-cell markers. Blood. 2006 Jan 1;107(1):213-21. Epub 2005 Sep 13. [PubMed:16160011 ]