Hmdb loader
Identification
HMDB Protein ID HMDBP07607
Secondary Accession Numbers
  • 13316
Name Putative claudin-24
Synonyms Not Available
Gene Name CLDN24
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell-cell junction
occluding junction
tight junction
membrane
cell part
membrane part
plasma membrane part
cell junction
Function
structural molecule activity
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Cell junction
  4. tight junction
Gene Properties
Chromosome Location Chromosome:4
Locus 4q35.1
SNPs CLDN24
Gene Sequence Not Available
Protein Properties
Number of Residues 205
Molecular Weight 22801.6
Theoretical pI 5.17
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 11-31
  • 82-102
  • 118-138
  • 162-182
Protein Sequence
>Putative claudin-24
MALIFRTAMQSVGLLLSLLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEV
GMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLI
LGGILSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGG
CLLNCAACSSHAPLALGHYAVAQMQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID A6NM45
UniProtKB/Swiss-Prot Entry Name CLD24_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID CLDN24
GenAtlas ID CLDN24
HGNC ID HGNC:37200
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]