Hmdb loader
Identification
HMDB Protein ID HMDBP03270
Secondary Accession Numbers
  • 8845
  • HMDBP07048
Name Cytochrome c oxidase subunit 8A, mitochondrial
Synonyms
  1. Cytochrome c oxidase polypeptide VIII-liver/heart
  2. Cytochrome c oxidase subunit 8-2
Gene Name COX8A
Protein Type Enzyme
Biological Properties
General Function Involved in cytochrome-c oxidase activity
Specific Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Cellular Location
  1. Mitochondrion inner membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 11q12-q13
SNPs COX8A
Gene Sequence
>210 bp
ATGTCCGTCCTGACGCCGCTGCTGCTGCGGGGCTTGACAGGCTCGGCCCGGCGGCTCCCA
GTGCCGCGCGCCAAGATCCATTCGTTGCCGCCGGAGGGGAAGCTTGGGATCATGGAATTG
GCCGTTGGGCTTACCTCCTGCTTCGTGACCTTCCTCCTGCCAGCGGGCTGGATCCTGTCA
CACCTGGAGACCTACAGGAGGCCAGAGTGA
Protein Properties
Number of Residues 69
Molecular Weight 7579.0
Theoretical pI 10.83
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 37-60
Protein Sequence
>Cytochrome c oxidase subunit 8A, mitochondrial
MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS
HLETYRRPE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P10176
UniProtKB/Swiss-Prot Entry Name COX8A_HUMAN
PDB IDs Not Available
GenBank Gene ID J04823
GeneCard ID COX8A
GenAtlas ID COX8A
HGNC ID HGNC:2294
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rizzuto R, Nakase H, Darras B, Francke U, Fabrizi GM, Mengel T, Walsh F, Kadenbach B, DiMauro S, Schon EA: A gene specifying subunit VIII of human cytochrome c oxidase is localized to chromosome 11 and is expressed in both muscle and non-muscle tissues. J Biol Chem. 1989 Jun 25;264(18):10595-600. [PubMed:2543673 ]
  3. Van Kuilenburg AB, Muijsers AO, Demol H, Dekker HL, Van Beeumen JJ: Human heart cytochrome c oxidase subunit VIII. Purification and determination of the complete amino acid sequence. FEBS Lett. 1988 Nov 21;240(1-2):127-32. [PubMed:2847943 ]