Hmdb loader

Showing Protein Cytochrome b-c1 complex subunit 8 (HMDBP02273)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 3 metabolites
Identification
HMDB Protein ID HMDBP02273
Secondary Accession Numbers
  • 7758
Name Cytochrome b-c1 complex subunit 8
Synonyms
  1. Complex III subunit 8
  2. Complex III subunit VIII
  3. Ubiquinol-cytochrome c reductase complex 9.5 kDa protein
  4. Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C
Gene Name UQCRQ
Protein Type Enzyme
Biological Properties
General Function Involved in ubiquinol-cytochrome-c reductase activity
Specific Function This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone
Pathways Not Available
Reactions Not Available
GO Classification
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
ubiquinol-cytochrome-c reductase activity
transporter activity
Cellular Location
  1. Mitochondrion inner membrane
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31.1
SNPs UQCRQ
Gene Sequence 
>249 bp
ATGGGCCGCGAGTTTGGGAATCTGACGCGGATGCGGCATGTGATCAGCTACAGCTTGTCA
CCGTTCGAGCAGCGCGCCTATCCGCACGTCTTCACTAAAGGAATCCCCAATGTTCTGCGC
CGCATTCGGGAGTCTTTCTTTCGCGTGGTGCCGCAGTTTGTAGTGTTTTATCTTATCTAC
ACATGGGGGACTGAAGAGTTCGAGAGATCCAAGAGGAAGAATCCAGCTGCCTATGAAAAT
GACAAATGA
Protein Properties
Number of Residues 82
Molecular Weight 9906.3
Theoretical pI 10.5
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>Cytochrome b-c1 complex subunit 8
MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
TWGTEEFERSKRKNPAAYENDK
GenBank ID Protein 12655079
UniProtKB/Swiss-Prot ID O14949
UniProtKB/Swiss-Prot Entry Name QCR8_HUMAN
PDB IDs Not Available
GenBank Gene ID BC001390
GeneCard ID UQCRQ
GenAtlas ID UQCRQ
HGNC ID HGNC:29594
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Schagger H, Brandt U, Gencic S, von Jagow G: Ubiquinol-cytochrome-c reductase from human and bovine mitochondria. Methods Enzymol. 1995;260:82-96. [PubMed:8592474 ]
  3. Barel O, Shorer Z, Flusser H, Ofir R, Narkis G, Finer G, Shalev H, Nasasra A, Saada A, Birk OS: Mitochondrial complex III deficiency associated with a homozygous mutation in UQCRQ. Am J Hum Genet. 2008 May;82(5):1211-6. doi: 10.1016/j.ajhg.2008.03.020. Epub 2008 Apr 24. [PubMed:18439546 ]